PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr003875.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family GRAS
Protein Properties Length: 739aa    MW: 82811.9 Da    PI: 5.2493
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr003875.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS385.75.2e-1183637331373
         GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshlta 98 
                  l+ lL+ cA+avs++d + a++lL+++++++sp gd  qRla++f+++L+arla+++++ly al++++ts    ++ l+a++++ +++P++k   + a
  Pbr003875.1 363 LRALLILCAQAVSADDRRTASELLKQIRQHSSPFGDGSQRLAHCFANGLEARLAGTGTQLYTALSSKRTS---AADMLKAYQTYIKACPFMKAVIVFA 457
                  5789************************************************************999999...9************************ PP

         GRAS  99 NqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledleleeL 194
                  N++I + +e++e++HiiDf+i +G+QWpaL++ L+ R++gpp+lRiTg++ p+sg   +e+++etg+rLak++e+ +vpfe+n  +ak++e++++eeL
  Pbr003875.1 458 NRTISKLAEKAETLHIIDFGILYGFQWPALIHCLSGRAGGPPKLRITGIELPQSGfrPEERVQETGHRLAKYCERYNVPFEYNG-IAKKWETIQYEEL 554
                  ******************************************************9*****************************.7************ PP

         GRAS 195 rvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgr 292
                  +vk++E+laVn+ ++ ++llde+v+++s+rd+vL+l+++++P++++++  + ++n++ F++rf eal ++sa+fd+ +++lpre+ +r + E+e+lgr
  Pbr003875.1 555 KVKRDEVLAVNSLFRFYNLLDETVAVNSPRDAVLNLIRGMNPDIFILSIVNGSYNAPFFVTRFREALFHFSAFFDMCDTNLPREDPTRLMFEEEFLGR 652
                  ************************************************************************************************** PP

         GRAS 293 eivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                  eivn vaceg+er+ r et+++W+ r ++aGFk++pl+ + +++ ++ ++  + + + v+e+ +++++gWk+r ++s S+W
  Pbr003875.1 653 EIVNTVACEGSERVVRPETYKQWQVRNTRAGFKQLPLDRELMNKLRSKVKLGYHRDFVVDEDGNWMLQGWKGRIIYSSSCW 733
                  *****************************************************999************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098566.646337714IPR005202Transcription factor GRAS
PfamPF035141.8E-115363733IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009410Biological Processresponse to xenobiotic stimulus
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
Sequence ? help Back to Top
Protein Sequence    Length: 739 aa     Download sequence    Send to blast
MDPSSYQLPN SNSNFIDHTL SPNFNEYPSS DPFVDLSFVD QNPSNSTLSP SLSPEGDDSD  60
YSDSVLKYIN QVLLEEDMET KPCMFHDPLA VQAAEKTLYE VLGGKFPASP DQHPVNVESP  120
DGCSSATFSD YSGKTSSSSS SSSNSTTSHS VDSWSSSVDV IEHKPSILQN PIPENFVFQS  180
NSMPKSQFSS KGDGLVGSYV SERMLSNLFS ESEMVLQFNR GVEEASKFLP KGQLIVDLEN  240
NKPYTMADRK AENVVVKMEK DESEYFSSSL RGKKSHERED TDLEDGRSTK QSAVYEDMAD  300
LSEIFDKVLI CSEGKPDAIG CKGEQVCQDE ANKALQQNEQ SVGTSNGRTR AKKNGDKKEV  360
VDLRALLILC AQAVSADDRR TASELLKQIR QHSSPFGDGS QRLAHCFANG LEARLAGTGT  420
QLYTALSSKR TSAADMLKAY QTYIKACPFM KAVIVFANRT ISKLAEKAET LHIIDFGILY  480
GFQWPALIHC LSGRAGGPPK LRITGIELPQ SGFRPEERVQ ETGHRLAKYC ERYNVPFEYN  540
GIAKKWETIQ YEELKVKRDE VLAVNSLFRF YNLLDETVAV NSPRDAVLNL IRGMNPDIFI  600
LSIVNGSYNA PFFVTRFREA LFHFSAFFDM CDTNLPREDP TRLMFEEEFL GREIVNTVAC  660
EGSERVVRPE TYKQWQVRNT RAGFKQLPLD RELMNKLRSK VKLGYHRDFV VDEDGNWMLQ  720
GWKGRIIYSS SCWVPSRS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A4e-433677338374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009364375.10.0PREDICTED: scarecrow-like protein 14
SwissprotQ9XE580.0SCL14_ARATH; Scarecrow-like protein 14
TrEMBLA0A061GX450.0A0A061GX45_THECC; SCARECROW-like 14, putative
STRINGPOPTR_0009s03790.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF13134339
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07530.10.0SCARECROW-like 14